General Information

  • ID:  hor002093
  • Uniprot ID:  Q9TRM8
  • Protein name:  Relaxin A chain
  • Gene name:  RLN
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Placenta; syncytiotrophoblast.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DNYIKMSDKCCNVGCTRRELASRC
  • Length:  24(154-177)
  • Propeptide:  MLRWFLSHLLGVWLLLSQLPREIPATDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRERRQISEPLAEVVPSSIINDPEILSLMLQSIPGMPQELRIATRSGKEKLLRELHFVLEDSNLNLEEMKKTFLNTQFEAEDKSLSKLDKHPRKKRDNYIKMSDKCCNVGCTRRELASRC
  • Signal peptide:  MLRWFLSHLLGVWLLLSQLPREIPA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2
  • Target Unid:   Q5XM32
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-Q9TRM8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002093_AF2.pdbhor002093_ESM.pdb

Physical Information

Mass: 317663 Formula: C109H185N37O37S5
Absent amino acids: FHPQW Common amino acids: C
pI: 8.33 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 4
Hydrophobicity: -69.17 Boman Index: -7880
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 48.75
Instability Index: 7633.75 Extinction Coefficient cystines: 1740
Absorbance 280nm: 75.65

Literature

  • PubMed ID:  1388669
  • Title:  Purification and sequence determination of canine relaxin.